PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007284.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 362aa    MW: 40415.6 Da    PI: 7.6001
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007284.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.91.4e-55171421128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL+kkv ++++++ +++ evd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat +gyWkatgkdke+++  ++
  Pbr007284.1  17 LPPGFRFHPTDEELISHYLHKKVIDTSFSC-KAMGEVDLNKSEPWQLPLKAKMGEKEWYFFCVRDRKYPTGLRTNRATGAGYWKATGKDKEIYR-AKS 112
                  79****************************.88***************99999*****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  lvg+kktLvfykgrapkgek++Wvmheyrl
  Pbr007284.1 113 LVGMKKTLVFYKGRAPKGEKSNWVMHEYRL 142
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6214167IPR003441NAC domain
PROSITE profilePS5100558.75617167IPR003441NAC domain
PfamPF023653.6E-2918142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MENVPAGIVE EDDQIDLPPG FRFHPTDEEL ISHYLHKKVI DTSFSCKAMG EVDLNKSEPW  60
QLPLKAKMGE KEWYFFCVRD RKYPTGLRTN RATGAGYWKA TGKDKEIYRA KSLVGMKKTL  120
VFYKGRAPKG EKSNWVMHEY RLDGKFSVHN LPKTAKNEWV ICRVFEKNSG GKKTHISGFM  180
TLASLGNEIG PSGLPPLMDS SPYSPAKAKP ASESHYVPCF SNPDPADVQR NQGNIVDYMN  240
NNPLFGVSSN SSNFFPRIPL PNSFYSAHNA PISTSSKFPG SDILQDQSIL RALLENNAAN  300
MRQQSYKTDR EMVSVSQETG LTSDMNAEIS SVMSNLEMAT RPYGDQDPPA EAAGLDNFWN  360
Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-5771735171NAC domain-containing protein 19
4dul_A2e-5771735171NAC domain-containing protein 19
1ut7_B2e-5771735171NO APICAL MERISTEM PROTEIN
1ut7_A2e-5771735171NO APICAL MERISTEM PROTEIN
1ut4_B2e-5771735171NO APICAL MERISTEM PROTEIN
1ut4_A2e-5771735171NO APICAL MERISTEM PROTEIN
3swp_D2e-5771738174NAC domain-containing protein 19
3swp_C2e-5771738174NAC domain-containing protein 19
3swp_B2e-5771738174NAC domain-containing protein 19
3swp_A2e-5771738174NAC domain-containing protein 19
3swm_D2e-5771738174NAC domain-containing protein 19
3swm_C2e-5771738174NAC domain-containing protein 19
3swm_B2e-5771738174NAC domain-containing protein 19
3swm_A2e-5771738174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981280.0KF198128.1 Malus hupehensis NAC domain protein (NAC138) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338985.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-147NC100_ARATH; NAC domain-containing protein 100
TrEMBLS5RUX40.0S5RUX4_9R
STRINGPOPTR_0015s02170.11e-180(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-149NAC domain containing protein 100